Return to main results Retrieve Phyre Job Id

Job DescriptionP32143
Confidence73.36%DateThu Jan 5 11:49:29 GMT 2012
Rank68Aligned Residues29
% Identity41%Templatec1i8tB_
PDB info PDB header:isomeraseChain: B: PDB Molecule:udp-galactopyranose mutase; PDBTitle: strcuture of udp-galactopyranose mutase from e.coli
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30......... 40.........50........
Predicted Secondary structure 
















.



Query SS confidence 






































.


















Query Sequence  MIRVACVGITVMDRIYYVEGLPTESGKYVARNYTEVGGG. PAATAAVAAARLGAQVDFI
Query Conservation 
 


 

   

                        

.   
 
  
  

      
Alig confidence 







.............................

.


















Template Conservation 
 





.............................





 

  
   
  
 

Template Sequence  MYDYIIVG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . SGLFGAVCANELKKLNKKVLVI
Template Known Secondary structure 

.............................
STT

Template Predicted Secondary structure 


.............................




Template SS confidence 


























































   1....... .10.........20.........30
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions