Return to main results Retrieve Phyre Job Id

Job DescriptionP32143
Confidence51.11%DateThu Jan 5 11:49:29 GMT 2012
Rank79Aligned Residues49
% Identity24%Templatec1gqqA_
PDB info PDB header:cell wall biosynthesisChain: A: PDB Molecule:udp-n-acetylmuramate-l-alanine ligase; PDBTitle: murc - crystal structure of the apo-enzyme from haemophilus2 influenzae
Resolution3.1 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40. ........50.........60.........70.........
Predicted Secondary structure 
















.









Query SS confidence 








































.





































Query Sequence  MIRVACVGITVMDRIYYVEGLPTESGKYVARNYTEVGGGPA. ATAAVAAARLGAQVDFIGRVGDDDTGNSLLAELESWGV
Query Conservation 
 


 

   

                        

  . 
 
  
  

        

 
  
  
   
    
Alig confidence 








............................



.














.....

















Template Conservation   
 


 
 ............................ 
 
 
 

  
   
  
 .....  
         
   

Template Sequence  VQQIHFIGI. . . . . . . . . . . . . . . . . . . . . . . . . . . . GGAGMSGIAEILLNEGYQIS. . . . . GSDIADGVVTQRLAQAGA
Template Known Secondary structure 

ST............................TSTTT
.....S

ST
Template Predicted Secondary structure 



............................






.....






Template SS confidence 















































































   18.20...... ...30.........40...... ...50.........60....
 
   80..
Predicted Secondary structure 
Query SS confidence 


Query Sequence  NTR
Query Conservation     
Alig confidence 


Template Conservation     
Template Sequence  KIY
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 


   65..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions