Return to main results Retrieve Phyre Job Id

Job DescriptionP77656
Confidence4.17%DateThu Jan 5 12:31:23 GMT 2012
Rank36Aligned Residues29
% Identity17%Templatec3izct_
PDB info PDB header:ribosomeChain: T: PDB Molecule:60s ribosomal protein rpl19 (l19e); PDBTitle: localization of the large subunit ribosomal proteins into a 6.1 a2 cryo-em map of saccharomyces cerevisiae translating 80s ribosome
ResolutionNULL Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2930.........40.........50.........60.....
Predicted Secondary structure 




















Query SS confidence 




































Query Sequence  DDAVEVDEQVYIEFSGLPPKGKIRIAGENGFPAWSEI
Query Conservation   


 



    
      

 
     
 
 


 
Alig confidence 















........












Template Conservation 
    

 
 
  
 
........



 

  

 
Template Sequence  DSEIEISSEKLLTLTN. . . . . . . . AANVPDENIWADI
Template Known Secondary structure  T


S........T



Template Predicted Secondary structure 






........




Template SS confidence 




































   16...20.........30. ........40....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions