Return to main results Retrieve Phyre Job Id

Job DescriptionP77656
Confidence2.39%DateThu Jan 5 12:31:23 GMT 2012
Rank77Aligned Residues26
% Identity46%Templatec2lbfA_
PDB info PDB header:ribosomal proteinChain: A: PDB Molecule:60s acidic ribosomal protein p1; PDBTitle: solution structure of the dimerization domain of human ribosomal2 protein p1/p2 heterodimer
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2930.........40.........50.........60..
Predicted Secondary structure 

















Query SS confidence 

































Query Sequence  DDAVEVDEQVYIEFSGLPPKGKIRIAGENGFPAW
Query Conservation   


 



    
      

 
     
 
 
Alig confidence 















........









Template Conservation 

   



 
  


........



 


 
Template Sequence  DDEVTVTEDKINALIK. . . . . . . . AAGVNVEPFW
Template Known Secondary structure  T



........T



T
Template Predicted Secondary structure 






........


Template SS confidence 

































   18.20.........30... ......40...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions