Return to main results Retrieve Phyre Job Id

Job DescriptionP76466
Confidence34.02%DateThu Jan 5 12:23:12 GMT 2012
Rank17Aligned Residues29
% Identity21%Templated1zcea1
SCOP infoPUA domain-like PUA domain-like Atu2648/PH1033-like
Resolution1.30

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   130.........140.........150.........160.........170.....
Predicted Secondary structure 




















Query SS confidence 













































Query Sequence  INQALPGDMIFFDQGDAQHLMVWMGRYVIYHTGSATKTDNGMRAVS
Query Conservation 
  
 






 
 

 



  
   




  
  
  

 
 
Alig confidence 











.................
















Template Conservation 

 

 

 


.................


    





 
  
Template Sequence  XRAXKIGDKGFF. . . . . . . . . . . . . . . . . YHSNEGLDVVGIVEVCA
Template Known Secondary structure  T

TT
.................TTTT
Template Predicted Secondary structure 




.................





Template SS confidence 













































   41........50.. .......60.........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions