Return to main results Retrieve Phyre Job Id

Job DescriptionP76466
Confidence10.90%DateThu Jan 5 12:23:12 GMT 2012
Rank63Aligned Residues23
% Identity26%Templated1iufa1
SCOP infoDNA/RNA-binding 3-helical bundle Homeodomain-like Centromere-binding
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   25....30.........40.........50......
Predicted Secondary structure 







Query SS confidence 































Query Sequence  EQSGLFRAWFVRIAQEQLRQGPSPRWYQQDCA
Query Conservation 


  

 


 


 
 
  
 

  




Alig confidence 









.........












Template Conservation   

 


   .........     
 


 
 
Template Sequence  HEKRALRHYF. . . . . . . . . FQLQNRSGQQDLI
Template Known Secondary structure  .........SSSS


Template Predicted Secondary structure  .........





Template SS confidence 































   12.......20. ........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions