Return to main results Retrieve Phyre Job Id

Job DescriptionP76466
Confidence46.04%DateThu Jan 5 12:23:12 GMT 2012
Rank16Aligned Residues32
% Identity34%Templatec3kopB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:uncharacterized protein; PDBTitle: crystal structure of protein with a cyclophilin-like fold2 (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   134.....140. ...... ..150.........160.....
Predicted Secondary structure 



........




...





Query SS confidence 







. . . . . . . .





. . .

















Query Sequence  LPGDMIFF. . . . . . . . DQGDAQ. . . HLMVWMGRYVIYHTGSAT
Query Conservation   






........ 
 

 ...



  
   




  
Alig confidence 







........





...

















Template Conservation   




 
         

 
    
  
 

 
   

 
 
Template Sequence  IPGDVCYFTFTSNDLKTPSHVQTIVDLAVFYGRNNLLLNGDTG
Template Known Secondary structure 
TTSSTT



SSS


TTT
Template Predicted Secondary structure 



























Template SS confidence 










































   74.....80.........90.........100.........110......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions