Return to main results Retrieve Phyre Job Id

Job DescriptionP76466
Confidence10.96%DateThu Jan 5 12:23:12 GMT 2012
Rank62Aligned Residues28
% Identity36%Templatec1lehB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:leucine dehydrogenase; PDBTitle: leucine dehydrogenase from bacillus sphaericus
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   156...160.........170... ......180...
Predicted Secondary structure 









.............


Query SS confidence 

















. . . . . . . . . . . . .









Query Sequence  YVIYHTGSATKTDNGMRA. . . . . . . . . . . . . VSLQQLMTWK
Query Conservation    




  
  
  

 .............
    

   
Alig confidence 

















.............









Template Conservation      
    

  

 
          
 
   

  

 
Template Sequence  VIAIHDTTLGPALGGARMWTYNAEEEAIEDALRLARGMTYK
Template Known Secondary structure 
SSSS



SS
Template Predicted Secondary structure 















Template SS confidence 








































   28.30.........40.........50.........60........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions