Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADK0
Confidence47.01%DateThu Jan 5 11:21:12 GMT 2012
Rank5Aligned Residues23
% Identity43%Templated1deeg_
SCOP infoimmunoglobulin/albumin-binding domain-like Bacterial immunoglobulin/albumin-binding domains Immunoglobulin-binding protein A modules
Resolution2.70

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   32.......40.........50.........60...
Predicted Secondary structure 












Query SS confidence 































Query Sequence  DQRKAFIDFLQNTVMRSGERLPTLTADQKKQF
Query Conservation 






 


  
   

 

 

  




Alig confidence 











.........










Template Conservation   

 





 
.........


 






Template Sequence  DQQSAFYEILNM. . . . . . . . . PNLNEAQRNGF
Template Known Secondary structure 

.........SSS
Template Predicted Secondary structure 


.........



Template SS confidence 































   1806...1810....... ..1820........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions