Return to main results Retrieve Phyre Job Id

Job DescriptionP19932
Confidence4.96%DateThu Jan 5 11:37:41 GMT 2012
Rank58Aligned Residues39
% Identity15%Templatec3ju2A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein smc04130; PDBTitle: crystal structure of protein smc04130 from sinorhizobium meliloti 1021
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   226...230.........240.........250.........260.........270.......
Predicted Secondary structure 

















Query SS confidence 



















































Query Sequence  ATGLRHVWHLRCTDTLKGPLLESYEICPIPEVVLAAPEDLVDSAQRLSEVCQ
Query Conservation   
   


 
  

  
  

 



  

 

 

 


 

  

 


 
Alig confidence 
















.............





















Template Conservation    

 
   

      .............                 
    
Template Sequence  AAGFHGAQEVEIFSADN. . . . . . . . . . . . . WWKRPADEVIATCVERYRNCCE
Template Known Secondary structure  TT






BTTT.............GGGS
T
Template Predicted Secondary structure 








.............


Template SS confidence 



















































   237..240.........250... ......260.........270.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions