Return to main results Retrieve Phyre Job Id

Job DescriptionP77588
Confidence1.71%DateThu Jan 5 12:30:49 GMT 2012
Rank92Aligned Residues34
% Identity15%Templatec3nqnB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:uncharacterized protein; PDBTitle: crystal structure of a protein with unknown function. (dr_2006) from2 deinococcus radiodurans at 1.88 a resolution
Resolution1.88 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   271........280......... 290...... ...300....
Predicted Secondary structure 






...................
Query SS confidence 


















. . . . . . . . . . . . . . .






. . . .







Query Sequence  SKVPLGLSATYGQTGNKVS. . . . . . . . . . . . . . . AGTVQSV. . . . IGVTFIYE
Query Conservation          
 
  
   

............... 
   
 .... 
    

Alig confidence 


















...............






....







Template Conservation 










  

 

 
 
  















 


  

 
 

Template Sequence  GEVDLPFRSEIVRTPQGAELRPLTLTGERAWVAVSGQATAAEGGEXAFAFQFQ
Template Known Secondary structure  TT



TTS

TTS
Template Predicted Secondary structure 




























Template SS confidence 




















































   5960.........70.........80.........90.........100.........110.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions