Return to main results Retrieve Phyre Job Id

Job DescriptionP0C0V0
Confidence30.08%DateThu Jan 5 11:30:02 GMT 2012
Rank463Aligned Residues35
% Identity14%Templatec3fosA_
PDB info PDB header:transferaseChain: A: PDB Molecule:sensor protein; PDBTitle: crystal structure of two-component sensor histidine kinase domain from2 bacillus subtilis subsp. subtilis str. 168
Resolution2.48 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   239240.........250.........260.........270.........280......
Predicted Secondary structure 











Query SS confidence 















































Query Sequence  ALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQV
Query Conservation 

    
 



               



          
      
Alig confidence 











.............






















Template Conservation 

    
   

.............
   
 
  
   
         
Template Sequence  PVLDSKRNVTDY. . . . . . . . . . . . . LVAAIQIDYLKNLINLLSPDVYI
Template Known Secondary structure 
SS

.............
TTS
Template Predicted Secondary structure 




.............



Template SS confidence 















































   128.130......... 140.........150.........160..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions