Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7W7
Confidence2.42%DateThu Jan 5 11:06:21 GMT 2012
Rank53Aligned Residues31
% Identity42%Templatec3n6oB_
PDB info PDB header:signaling proteinChain: B: PDB Molecule:guanine nucleotide exchange factor; PDBTitle: crystal structure of the gef and p4m domain of drra/sidm from2 legionella pneumophila
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30.........40.........
Predicted Secondary structure 











Query SS confidence 








































Query Sequence  DMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDF
Query Conservation 
 
  
 

       
 

 

    

 

  



   
Alig confidence 













..........
















Template Conservation                ..........                 
Template Sequence  HMVTRIENLENAKK. . . . . . . . . . LWDNANSMLEKGNISGY
Template Known Secondary structure  ..........T
Template Predicted Secondary structure 
..........


Template SS confidence 








































   338.340.........350. ........360........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions