Return to main results Retrieve Phyre Job Id

Job DescriptionP16430
Confidence4.68%DateThu Jan 5 11:35:06 GMT 2012
Rank25Aligned Residues38
% Identity21%Templated2i5nm1
SCOP infoBacterial photosystem II reaction centre, L and M subunits Bacterial photosystem II reaction centre, L and M subunits Bacterial photosystem II reaction centre, L and M subunits
Resolution1.96

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30....... ..40......
Predicted Secondary structure 




................
Query SS confidence 




























. . . . . . . . . . . . . . . .








Query Sequence  QALVLFAVAPLLSGITRVARARLHNRRGP. . . . . . . . . . . . . . . . GVLQEYRDI
Query Conservation                 



 



 
 

................




  
 
Alig confidence 




























................








Template Conservation   

 

  


  

 
 
  






 


 

 


     
  



 

Template Sequence  LMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAAAIFFVLCIGCIHPTLVG
Template Known Secondary structure  TT

STT
Template Predicted Secondary structure 






Template SS confidence 





















































   114.....120.........130.........140.........150.........160.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions