Return to main results Retrieve Phyre Job Id

Job DescriptionP26459
Confidence3.48%DateThu Jan 5 11:42:55 GMT 2012
Rank55Aligned Residues44
% Identity16%Templated2iuba2
SCOP infoTransmembrane helix hairpin Magnesium transport protein CorA, transmembrane region Magnesium transport protein CorA, transmembrane region
Resolution2.9

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   53......60.........70.........80.........90.........100.........110.........120
Predicted Secondary structure 

Query SS confidence 



































































Query Sequence  RFWGKLFGINFALGVATGLTMEFQFGTNWSFYSNYVGDIFGAPLAMEALMAFFLESTFVGLFFFGWQR
Query Conservation 
   
 
 
 

 





   
 

  

 

   
 


 


 
 
 




  



  


 
Alig confidence 


















.....




...................



















Template Conservation 
 


 
 





 



.....



 ...................    
          




Template Sequence  KVLTIIATIFMPLTFIAGI. . . . . YGYPV. . . . . . . . . . . . . . . . . . . VLAVMGVIAVIMVVYFKKKK
Template Known Secondary structure  TTS.....


...................TTTTS

Template Predicted Secondary structure  ........................

Template SS confidence 



































































   292.......300.........310 ..... ....320.........330.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions