Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEF8
Confidence12.95%DateThu Jan 5 11:23:12 GMT 2012
Rank29Aligned Residues27
% Identity37%Templatec2hw2A_
PDB info PDB header:transferaseChain: A: PDB Molecule:rifampin adp-ribosyl transferase; PDBTitle: crystal structure of rifampin adp-ribosyl transferase in2 complex with rifampin
Resolution1.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   30.........40. ........50......
Predicted Secondary structure 






............



Query SS confidence 











. . . . . . . . . . . .














Query Sequence  IPGDPVMIMAGE. . . . . . . . . . . . RGISPERHAQLLAEL
Query Conservation   
 

       ............               
Alig confidence 











............














Template Conservation 










  

 




  
  



 

 

  
Template Sequence  LPGNPTRSYRTREPVWIVGELTDWVGHPPEQLAAMRQGL
Template Known Secondary structure  SSS
TT
SS







Template Predicted Secondary structure 




















Template SS confidence 






































   92.......100.........110.........120.........130
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions