Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB58
Confidence63.78%DateThu Jan 5 11:14:41 GMT 2012
Rank188Aligned Residues23
% Identity26%Templated1x3za1
SCOP infoCysteine proteinases Cysteine proteinases Transglutaminase core
Resolution2.80

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   355....360. ........ 370.......
Predicted Secondary structure 

..







.......







Query SS confidence 






. .







. . . . . . .







Query Sequence  YRCQKCG. . FTAYTLYW. . . . . . . HCPSCRAW
Query Conservation 
 
  
 ..        ....... 

 
   
Alig confidence 






..







.......







Template Conservation 
 
  
    





 
  

 

 





Template Sequence  YKCNRCGNITRFPRYNDPIKLLETRKGRCGEW
Template Known Secondary structure  TTT





Template Predicted Secondary structure 















Template SS confidence 































   163......170.........180.........190....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions