Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB58
Confidence33.14%DateThu Jan 5 11:14:41 GMT 2012
Rank294Aligned Residues32
% Identity13%Templatec2v6xA_
PDB info PDB header:protein transportChain: A: PDB Molecule:vacuolar protein sorting-associated protein 4; PDBTitle: stractural insight into the interaction between escrt-iii2 and vps4
Resolution1.98 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   51........60.........70.........80.........90.......
Predicted Secondary structure 









Query SS confidence 














































Query Sequence  QDKAVDLFLDMLKEDTGTVEAHLTLGNLFRSRGEVDRAIRIHQTLME
Query Conservation   
 
      

   
        

      
    
       
 
Alig confidence 














...............
















Template Conservation 
  
      

  
...............    
 

   
  

 
Template Sequence  LTKGIELVQKAIDLD. . . . . . . . . . . . . . . TATQYEEAYTAYYNGLD
Template Known Secondary structure  ...............TT
Template Predicted Secondary structure  ...............

Template SS confidence 














































   7..10.........20. ........30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions