Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB58
Confidence29.63%DateThu Jan 5 11:14:41 GMT 2012
Rank304Aligned Residues22
% Identity27%Templatec2eozA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:zinc finger protein 473; PDBTitle: solution structure of the c2h2 type zinc finger (region 809-2 841) of human zinc finger protein 473
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   354.....360........ .370.....
Predicted Secondary structure 









.............






Query SS confidence 














. . . . . . . . . . . . .






Query Sequence  RYRCQKCGFTAYTLY. . . . . . . . . . . . . WHCPSCR
Query Conservation   
 
  
        .............  

 
 
Alig confidence 














.............






Template Conservation 
  
  
 
 
     
  
 
 
      
  

Template Sequence  PYSCNVCGKAFVLSAHLNQHLRVHTQETLSGPSSG
Template Known Secondary structure  STTTTSSSS

SSS



Template Predicted Secondary structure 























Template SS confidence 


































   12.......20.........30.........40......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions