Return to main results Retrieve Phyre Job Id

Job DescriptionP76227
Confidence3.34%DateThu Jan 5 12:20:53 GMT 2012
Rank49Aligned Residues25
% Identity24%Templatec1a0iA_
PDB info PDB header:ligaseChain: A: PDB Molecule:dna ligase; PDBTitle: atp-dependent dna ligase from bacteriophage t7 complex with2 atp
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   58.60.........70.........80.........90
Predicted Secondary structure 
















Query SS confidence 
































Query Sequence  EGAVIKAEGILLQCQRDDKTLSTNPLVWRRVKP
Query Conservation 




 
 

 


      
 
  
 
  


Alig confidence 


















........





Template Conservation 



 
   
 
  

   ........
 
 
 
Template Sequence  EGLIVKDPMCIYKRGKKSG. . . . . . . . WWKMKP
Template Known Secondary structure 


TT

S........S
Template Predicted Secondary structure 













........
Template SS confidence 
































   217..220.........230..... ....240.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions