Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8A4
Confidence25.30%DateThu Jan 5 11:07:19 GMT 2012
Rank264Aligned Residues26
% Identity42%Templatec2yciX_
PDB info PDB header:transferaseChain: X: PDB Molecule:5-methyltetrahydrofolate corrinoid/iron sulfur protein PDBTitle: methyltransferase native
Resolution1.78 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   154.....160... ......170.........
Predicted Secondary structure 




........





Query SS confidence 









. . . . . . . .















Query Sequence  ILLGVSRCGK. . . . . . . . TPTSLYLAMQFGIRAA
Query Conservation 









........



 


 
 
 


Alig confidence 









........















Template Conservation   
 
 

 


 
 
      

  
   


 
Template Sequence  TVLGLSNVSQKCPDRPLINRTYLVMAMTAGLDAA
Template Known Secondary structure  GGGGGTT
SST

Template Predicted Secondary structure 












Template SS confidence 

































   194.....200.........210.........220.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions