Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADJ5
Confidence1.45%DateThu Jan 5 11:21:10 GMT 2012
Rank67Aligned Residues26
% Identity42%Templatec3mfnD_
PDB info PDB header:structural genomics, unknown functionChain: D: PDB Molecule:uncharacterized protein; PDBTitle: dfer_2879 protein of unknown function from dyadobacter fermentans
Resolution2.02 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   25....30........ .40.........50
Predicted Secondary structure  .......








Query SS confidence 













. . . . . . .











Query Sequence  ARHSLRRIRDTLRL. . . . . . . FFAKPRYVKPAG
Query Conservation 


  


   


....... 
 








Alig confidence 













.......











Template Conservation 
 






 

  

 

   
 
 






Template Sequence  AKRYLNNAKDILRDKGGKEDGFYQDSKYVKXAG
Template Known Secondary structure  T
TT

Template Predicted Secondary structure 







Template SS confidence 
































   16...20.........30.........40........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions