Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADJ5
Confidence1.37%DateThu Jan 5 11:21:10 GMT 2012
Rank73Aligned Residues24
% Identity29%Templatec3ls1A_
PDB info PDB header:photosynthesisChain: A: PDB Molecule:sll1638 protein; PDBTitle: crystal structure of cyanobacterial psbq from synechocystis2 sp. pcc 6803 complexed with zn2+
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   22.......30.........40.........50....
Predicted Secondary structure 








Query SS confidence 
































Query Sequence  GYLARHSLRRIRDTLRLFFAKPRYVKPAGTLRR
Query Conservation 





  


   


 
 








 


Alig confidence 
















.........






Template Conservation   

 
  
  

  


.........
 
 

 
Template Sequence  GLIADQNWVDTQTYIHG. . . . . . . . . PLGQLRR
Template Known Secondary structure  TT
T.........TTTT
Template Predicted Secondary structure  .........
Template SS confidence 
































   61........70....... ..80....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions