Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7B5
Confidence43.88%DateWed Jan 25 15:20:17 GMT 2012
Rank89Aligned Residues51
% Identity25%Templatec2i55C_
PDB info PDB header:isomeraseChain: C: PDB Molecule:phosphomannomutase; PDBTitle: complex of glucose-1,6-bisphosphate with phosphomannomutase from2 leishmania mexicana
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   166...170.........180.........190.........200.........210.........220.........230.........240.....
Predicted Secondary structure 





































Query SS confidence 















































































Query Sequence  LLLTDQKGLYTADPRSNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPGVIGDV
Query Conservation 










 

   
 
  
  
               
   



  

 

  
   

 
 
  
     
   
Alig confidence 















.........




......................



























Template Conservation 

  






     .........
    ......................  

  
   

 
 




        
Template Sequence  ILLFDVDGTLTPPRNP. . . . . . . . . ETHDM. . . . . . . . . . . . . . . . . . . . . . KEALLKARAAGFKLGVVGGSDFAKQKEQ
Template Known Secondary structure  STTTTSSTTS
.........

......................TT
SS
Template Predicted Secondary structure 










.........

......................






Template SS confidence 















































































   6...10.........20. ..... ...30.........40.........50....
 
   246.
Predicted Secondary structure 
Query SS confidence 

Query Sequence  ME
Query Conservation 
 
Alig confidence 

Template Conservation    
Template Sequence  LG
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 

   55.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions