Return to main results Retrieve Phyre Job Id

Job DescriptionP76169
Confidence2.42%DateThu Jan 5 12:20:02 GMT 2012
Rank43Aligned Residues27
% Identity33%Templatec2jp3A_
PDB info PDB header:transcriptionChain: A: PDB Molecule:fxyd domain-containing ion transport regulator 4; PDBTitle: solution structure of the human fxyd4 (chif) protein in sds2 micelles
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   78.80........ .90.........100....
Predicted Secondary structure 





.........
Query SS confidence 










. . . . . . . . .















Query Sequence  VDGVKLTLYDW. . . . . . . . . TGALIALCGMLIIVAG
Query Conservation 


  

  
 ......... 

 
 
 
  


 
Alig confidence 










.........















Template Conservation     



 


 


 



 
 



 

 



 
Template Sequence  VDKGSPFYYDWESLQLGGLIFGGLLCIAGIALALSG
Template Known Secondary structure  TSTTSGGGGGGTT
Template Predicted Secondary structure 










Template SS confidence 



































   4.....10.........20.........30.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions