Return to main results Retrieve Phyre Job Id

Job DescriptionP69432
Confidence10.14%DateThu Jan 5 12:11:36 GMT 2012
Rank59Aligned Residues28
% Identity14%Templated1b4ua_
SCOP infoLigA subunit of an aromatic-ring-opening dioxygenase LigAB LigA subunit of an aromatic-ring-opening dioxygenase LigAB LigA subunit of an aromatic-ring-opening dioxygenase LigAB
Resolution2.20

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   75....80.........90.........100.........110.
Predicted Secondary structure 












Query SS confidence 




































Query Sequence  NKLRFQKQQHHAAYQYTPQEYAESLAIPDELYQQLQK
Query Conservation 
  


  

         
 
  
 
    
  

 
Alig confidence 







.........



















Template Conservation 




 

......... 




   





 


 
Template Sequence  NRERFKAD. . . . . . . . . ESAYLDEWNLTPAAKAAVLA
Template Known Secondary structure 
.........TTT

Template Predicted Secondary structure 
.........



Template SS confidence 




































   4950...... ...60.........70......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions