Return to main results Retrieve Phyre Job Id

Job DescriptionP0AA10
Confidence9.05%DateThu Jan 5 11:11:44 GMT 2012
Rank46Aligned Residues36
% Identity17%Templated1v1qa_
SCOP infoOB-fold Nucleic acid-binding proteins Single strand DNA-binding domain, SSB
Resolution2.1

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40.........50.......
Predicted Secondary structure 























Query SS confidence 

















































Query Sequence  PETVKRDWYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVL
Query Conservation       
 
 



    





 


 
 




 
 
  
 

 



Alig confidence 













..













............







Template Conservation            
 

..  
  

     
 ............

  
 
 
Template Sequence  AGFHRQAWCQMPVI. . VSGHENQAITHSIT. . . . . . . . . . . . VGSRITVQ
Template Known Secondary structure  TT..STGGGGGGTT

............TT
Template Predicted Secondary structure 



..


............


Template SS confidence 

















































   40.........50... ......60....... ..70.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions