Return to main results Retrieve Phyre Job Id

Job DescriptionP0AA10
Confidence5.59%DateThu Jan 5 11:11:44 GMT 2012
Rank75Aligned Residues24
% Identity21%Templatec2r37A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:glutathione peroxidase 3; PDBTitle: crystal structure of human glutathione peroxidase 3 (selenocysteine to2 glycine mutant)
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   16...20....... ..30.........
Predicted Secondary structure 




.........


Query SS confidence 











. . . . . . . . .











Query Sequence  YVVDATGKTLGR. . . . . . . . . LATELARRLRGK
Query Conservation   



    


.........


 


 
 

Alig confidence 











.........











Template Conservation 



  
 

        
  
   
  

   
Template Sequence  FLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQ
Template Known Secondary structure 
TTS

TTS
Template Predicted Secondary structure 








Template SS confidence 
































   186...190.........200.........210........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions