Return to main results Retrieve Phyre Job Id

Job DescriptionP0AA10
Confidence11.21%DateThu Jan 5 11:11:44 GMT 2012
Rank39Aligned Residues27
% Identity37%Templatec2ihfA_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:single-stranded dna-binding protein; PDBTitle: crystal structure of deletion mutant delta 228-252 r190a of the2 single-stranded dna binding protein from thermus aquaticus
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   15....20.........30.........40.........50.......
Predicted Secondary structure 




















Query SS confidence 










































Query Sequence  WYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVL
Query Conservation 
 



    





 


 
 




 
 
  
 

 



Alig confidence 






....











............







Template Conservation     
   ....
  

     
 ............

  
 
 
Template Sequence  YHRVRLL. . . . GRQAEMWGDLLE. . . . . . . . . . . . KGQLIFVE
Template Known Secondary structure  ....TTTT

............TT
Template Predicted Secondary structure  ....


............


Template SS confidence 










































   53...... 60.........70. ........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions