Return to main results Retrieve Phyre Job Id

Job DescriptionP0AA10
Confidence8.59%DateThu Jan 5 11:11:44 GMT 2012
Rank48Aligned Residues28
% Identity36%Templatec2iheA_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:single-stranded dna-binding protein; PDBTitle: crystal structure of wild-type single-stranded dna binding protein2 from thermus aquaticus
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   14.....20.........30.........40.........50.......
Predicted Secondary structure 




















Query SS confidence 











































Query Sequence  DWYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVL
Query Conservation   
 



    





 


 
 




 
 
  
 

 



Alig confidence 







....











............







Template Conservation      
   ....
  

     
 ............

  
 
 
Template Sequence  WYHRVRLL. . . . GRQAEMWGDLLE. . . . . . . . . . . . KGQLIFVE
Template Known Secondary structure  ....TTTT

............TT
Template Predicted Secondary structure 
....


............


Template SS confidence 











































   52....... 60.........70. ........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions