Return to main results Retrieve Phyre Job Id

Job DescriptionP06627
Confidence2.23%DateThu Jan 5 10:59:18 GMT 2012
Rank73Aligned Residues24
% Identity29%Templatec2jkgA_
PDB info PDB header:protein-bindingChain: A: PDB Molecule:profilin; PDBTitle: plasmodium falciparum profilin
Resolution1.89 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   67..70....... ..80.........90
Predicted Secondary structure 
......


Query SS confidence 










. . . . . .












Query Sequence  VKYLTMRLDDE. . . . . . TNQLLIAAKNRSG
Query Conservation 

 
  


  ......

  
 


 


Alig confidence 










......












Template Conservation   

  

 
      
        



 
Template Sequence  TKYQFINIERDLEFEGYNFDVATCAKLKGG
Template Known Secondary structure  TTTT
Template Predicted Secondary structure 














Template SS confidence 





























   99100.........110.........120........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions