Return to main results Retrieve Phyre Job Id

Job DescriptionP38392
Confidence6.18%DateThu Jan 5 11:58:06 GMT 2012
Rank55Aligned Residues47
% Identity13%Templated1dmga_
SCOP infoRibosomal protein L4 Ribosomal protein L4 Ribosomal protein L4
Resolution1.70

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10.........20.........30.........40.........50.........60.........70..
Predicted Secondary structure 








Query SS confidence 






























































Query Sequence  KLFANEPLERLMYTIIIFGLTLWLIPKEFTVAFNAYTEIPWLFQIIVFAFSFVVAISFSRLRA
Query Conservation 
 
  

 

 






 






  


 



  

 
 

  

 





   
   
Alig confidence 


















......










..........
















Template Conservation   

       


  
  
...... 



 




..........

 



 


 
   
Template Sequence  FVFNIDPNYDVMWRYVDMQ. . . . . . LSDWSKKLNKK. . . . . . . . . . MKKLALRSALSVKYREN
Template Known Secondary structure  SS


......

..........TT
Template Predicted Secondary structure 





......






..........

Template SS confidence 






























































   22.......30.........40 .........50. ........60........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions