Return to main results Retrieve Phyre Job Id

Job DescriptionP38392
Confidence4.79%DateThu Jan 5 11:58:06 GMT 2012
Rank76Aligned Residues26
% Identity27%Templatec2v52M_
PDB info PDB header:structural protein/contractile proteinChain: M: PDB Molecule:mkl/myocardin-like protein 1; PDBTitle: structure of mal-rpel2 complexed to g-actin
Resolution1.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   99100.........110.........120.........130
Predicted Secondary structure 









Query SS confidence 































Query Sequence  KDFLKTGNLIITSPCRNPVMKKLERKGIIQHQ
Query Conservation    


       
   

    

 



   
Alig confidence 




......




















Template Conservation 
  

...... 





 









 

Template Sequence  EDYLK. . . . . . RKIRSRPERAELVRMHILEET
Template Known Secondary structure  S......T


TTSS


Template Predicted Secondary structure  ......



Template SS confidence 































   115.... 120.........130.........140
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions