Return to main results Retrieve Phyre Job Id

Job DescriptionP0AE70
Confidence3.54%DateThu Jan 5 11:22:39 GMT 2012
Rank79Aligned Residues26
% Identity27%Templatec4a19F_
PDB info PDB header:ribosomeChain: F: PDB Molecule:rpl14; PDBTitle: t.thermophila 60s ribosomal subunit in complex with2 initiation factor 6. this file contains 26s rrna and3 proteins of molecule 2.
Resolution3.52 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30....
Predicted Secondary structure 





















Query SS confidence 
































Query Sequence  VSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVL
Query Conservation       





  
 
    
 
  
 

 


Alig confidence 




.














......





Template Conservation 
 


.





 
  
   
......

 


Template Sequence  FNKFV. QVGRVVYINYGADKG. . . . . . KLAVIV
Template Known Secondary structure 




.
TT
SSTTTT......
Template Predicted Secondary structure 


.






......
Template SS confidence 
































   3.... ..10.........20.. ......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions