Return to main results Retrieve Phyre Job Id

Job DescriptionP77306
Confidence5.84%DateThu Jan 5 12:27:33 GMT 2012
Rank61Aligned Residues28
% Identity21%Templatec1p58F_
PDB info PDB header:virusChain: F: PDB Molecule:envelope protein m; PDBTitle: complex organization of dengue virus membrane proteins as revealed by2 9.5 angstrom cryo-em reconstruction
Resolution9.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10......... 20.........30....
Predicted Secondary structure  ..........
Query SS confidence 












. . . . . . . . . .














Query Sequence  SVPSWMFTAIIAV. . . . . . . . . . CILFIIGIIFARLYR
Query Conservation            
  ..........               
Alig confidence 












..........














Template Conservation 





  
  
   


   




 





 

  
Template Sequence  RHPGFTIMAAILAYTIGTTHFQRVLIFILLTAIAPSMT
Template Known Secondary structure 
STTTGGGTTSSSTT
Template Predicted Secondary structure 








Template SS confidence 





































   38.40.........50.........60.........70.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions