Return to main results Retrieve Phyre Job Id

Job DescriptionP0AD40
Confidence1.87%DateThu Jan 5 11:19:55 GMT 2012
Rank84Aligned Residues28
% Identity25%Templated1mzga_
SCOP infoSufE/NifU SufE/NifU SufE-like
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   34.....40.........50.........60.........70
Predicted Secondary structure 








Query SS confidence 




































Query Sequence  WFARKDEFPAGKLGELMQITLLIKTEGLTQLVQPLKR
Query Conservation 



 
 

 



 

    


 



 
  



Alig confidence 





.........





















Template Conservation      

.........
   




 


 


  

 
Template Sequence  WFEKXA. . . . . . . . . LTQHLTPSRSQGLEAXIRAIRA
Template Known Secondary structure  T.........S
Template Predicted Secondary structure 
.........
Template SS confidence 




































   105....110 .........120.........130..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions