Return to main results Retrieve Phyre Job Id

Job DescriptionP0AD40
Confidence12.85%DateThu Jan 5 11:19:55 GMT 2012
Rank12Aligned Residues25
% Identity40%Templatec2hl2A_
PDB info PDB header:ligaseChain: A: PDB Molecule:threonyl-trna synthetase; PDBTitle: crystal structure of the editing domain of threonyl-trna2 synthetase from pyrococcus abyssi in complex with an3 analog of seryladenylate
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3..... .10......... 20.......
Predicted Secondary structure  ..





.......


Query SS confidence 





. .










. . . . . . .







Query Sequence  KEQLIE. . IANTIMPFGKY. . . . . . . KGRRLIDL
Query Conservation     
  ..

   





.......

  
 

Alig confidence 





..










.......







Template Conservation     
   
 

 







 
 
  







Template Sequence  YQGLKERGFNVGKAPFGYYKAFKISCKGHPLAEL
Template Known Secondary structure  TT


TT

STTT
Template Predicted Secondary structure 








Template SS confidence 

































   102.......110.........120.........130.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions