Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8H8
Confidence28.82%DateThu Jan 5 11:07:52 GMT 2012
Rank29Aligned Residues20
% Identity35%Templatec3qwvA_
PDB info PDB header:transferaseChain: A: PDB Molecule:set and mynd domain-containing protein 2; PDBTitle: crystal structure of histone lysine methyltransferase smyd2 in complex2 with the cofactor product adohcy
Resolution2.03 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30......
Predicted Secondary structure 






















Query SS confidence 





























Query Sequence  VNCPTCGKTVVWGEISPFRPFCSKRCQLID
Query Conservation 
 

 
 
          




 

  

Alig confidence 









..........









Template Conservation    
  
    ..........


  
    
Template Sequence  SKCGRCKQAF. . . . . . . . . . YCDVECQKED
Template Known Secondary structure 
TTTS

..........SS
Template Predicted Secondary structure 






..........



Template SS confidence 





























   63......70.. .......80..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions