Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8H8
Confidence49.90%DateThu Jan 5 11:07:52 GMT 2012
Rank6Aligned Residues21
% Identity24%Templatec3n71A_
PDB info PDB header:transcriptionChain: A: PDB Molecule:histone lysine methyltransferase smyd1; PDBTitle: crystal structure of cardiac specific histone methyltransferase smyd1
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30.......
Predicted Secondary structure 






















Query SS confidence 






























Query Sequence  VNCPTCGKTVVWGEISPFRPFCSKRCQLIDL
Query Conservation 
 

 
 
          




 

  


Alig confidence 









..........










Template Conservation    
  
    ..........


  
   
 
Template Sequence  HRCGQCKFAH. . . . . . . . . . YCDRTCQKDAW
Template Known Secondary structure 
TTTS

..........SS
Template Predicted Secondary structure 






..........

Template SS confidence 






























   63......70.. .......80...
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions