Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8H8
Confidence47.77%DateThu Jan 5 11:07:52 GMT 2012
Rank9Aligned Residues20
% Identity30%Templatec3mekA_
PDB info PDB header:transferaseChain: A: PDB Molecule:set and mynd domain-containing protein 3; PDBTitle: crystal structure of human histone-lysine n-2 methyltransferase smyd3 in complex with s-adenosyl-l-3 methionine
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30......
Predicted Secondary structure 






















Query SS confidence 





























Query Sequence  VNCPTCGKTVVWGEISPFRPFCSKRCQLID
Query Conservation 
 

 
 
          




 

  

Alig confidence 









..........









Template Conservation    
  
    ..........


  
    
Template Sequence  XRCSQCRVAK. . . . . . . . . . YCSAKCQKKA
Template Known Secondary structure 
TTTS

..........SS
Template Predicted Secondary structure 






..........

Template SS confidence 





























   60......... 70.........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions