Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8H8
Confidence40.41%DateThu Jan 5 11:07:52 GMT 2012
Rank13Aligned Residues24
% Identity29%Templatec2dj8A_
PDB info PDB header:metal binding proteinChain: A: PDB Molecule:protein cbfa2t1; PDBTitle: solution structure of zf-mynd domain of protein cbfa2ti2 (protein mtg8)
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30......
Predicted Secondary structure 


























Query SS confidence 

































Query Sequence  ETITVNCPTCGKTVVWGEISPFRPFCSKRCQLID
Query Conservation      
 

 
 
          




 

  

Alig confidence 













..........









Template Conservation        
  
  
 ..........


  

   
Template Sequence  RKASETCSGCNTAR. . . . . . . . . . YCGSFCQHKD
Template Known Secondary structure  S



TTTS

..........SST
Template Predicted Secondary structure 










..........

Template SS confidence 

































   23......30...... ...40......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions