Return to main results Retrieve Phyre Job Id

Job DescriptionP27249
Confidence85.56%DateThu Jan 5 11:43:29 GMT 2012
Rank112Aligned Residues35
% Identity20%Templatec2huoA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:inositol oxygenase; PDBTitle: crystal structure of mouse myo-inositol oxygenase in complex with2 substrate
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   466...470.........480.........490.........500.........510........
Predicted Secondary structure 
















Query SS confidence 




















































Query Sequence  YTVDEHTIRVMLKLESFASEETRQRHPLCVDVWPRLPSTELIFIAALFHDIAK
Query Conservation 



 


  
  
            
              
 

 






Alig confidence 

















..................
















Template Conservation 

   
 




 

   ..................
  

 

 







Template Sequence  FPNSFHAFQTAEGIRKAH. . . . . . . . . . . . . . . . . . PDKDWFHLVGLLHDLGK
Template Known Secondary structure  S

..................TT
TTGGG
Template Predicted Secondary structure 
..................


Template SS confidence 




















































   93......100.........110 .........120.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions