Return to main results Retrieve Phyre Job Id

Job DescriptionP11864
Confidence2.76%DateThu Jan 5 11:32:51 GMT 2012
Rank74Aligned Residues39
% Identity21%Templatec2vmlD_
PDB info PDB header:photosynthesisChain: D: PDB Molecule:phycocyanin beta chain; PDBTitle: the monoclinic structure of phycocyanin from gloeobacter2 violaceus
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   275....280 .........290.........300... ......310...
Predicted Secondary structure  ....
.............
Query SS confidence 





. . . .






















. . . . . . . . . . . . .









Query Sequence  KEIYKS. . . . SSKIINCLNRIKLTEMKEFSSEK. . . . . . . . . . . . . IYDYIDIIIE
Query Conservation 





....






















.............









Alig confidence 





....






















.............









Template Conservation 

 
  
 

      

  

         
                 


 

 
Template Sequence  KETYVALGTPTRSVARAVQLMKETAIGYVNSPSGVTRGDCSALVNEAATYFDKAAA
Template Known Secondary structure  T

S
SS





Template Predicted Secondary structure 












Template SS confidence 























































   114.....120.........130.........140.........150.........160.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions