Return to main results Retrieve Phyre Job Id

Job DescriptionP0C0T5
Confidence3.16%DateThu Jan 5 11:29:59 GMT 2012
Rank79Aligned Residues20
% Identity25%Templatec2aexA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:coproporphyrinogen iii oxidase, mitochondrial; PDBTitle: the 1.58a crystal structure of human coproporphyrinogen oxidase2 reveals the structural basis of hereditary coproporphyria
Resolution1.58 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   209210.........220.........230.........240...
Predicted Secondary structure 



















Query SS confidence 


































Query Sequence  HMHVRLRCPADSLECEDQPLPPSGDGCGAELQSWF
Query Conservation 
 


  

     
  
     



   
  
 
Alig confidence 















...............



Template Conservation 
 
 
 

        ............... 


Template Sequence  HFNYRYFEVEEADGNK. . . . . . . . . . . . . . . QWWF
Template Known Secondary structure 
STT
...............
Template Predicted Secondary structure 





...............

Template SS confidence 


































   258.260.........270... ....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions