Return to main results Retrieve Phyre Job Id

Job DescriptionP33669
Confidence5.78%DateThu Jan 5 11:52:38 GMT 2012
Rank16Aligned Residues14
% Identity43%Templated1zs4a1
SCOP infolambda repressor-like DNA-binding domains lambda repressor-like DNA-binding domains Bacteriophage CII protein
Resolution1.70

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   35....40.........50.........60....
Predicted Secondary structure 












Query SS confidence 





























Query Sequence  DESLVSKHYINYMAIPENDGVFTWLPDFFP
Query Conservation 

  


    
 



  

 



 


Alig confidence 





................







Template Conservation   




................


  
  
Template Sequence  DKSQIS. . . . . . . . . . . . . . . . RWKRDWIP
Template Known Secondary structure 
................T
Template Predicted Secondary structure 
................
Template SS confidence 





























   36...40. ........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions