Return to main results Retrieve Phyre Job Id

Job DescriptionP05719
Confidence8.90%DateThu Jan 5 10:58:51 GMT 2012
Rank98Aligned Residues28
% Identity29%Templatec3pmdA_
PDB info PDB header:lipid binding proteinChain: A: PDB Molecule:conserved domain protein; PDBTitle: crystal structure of the sporulation inhibitor pxo1-118 from bacillus2 anthracis
Resolution1.76 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   412.......420.........430.........440.........450..
Predicted Secondary structure 


















Query SS confidence 








































Query Sequence  SILAKAFRGELTAQWRAENPDLISGENSAAALLEKIKAERA
Query Conservation 


 
 




       
         
  

  
     
Alig confidence 














.............












Template Conservation   

   
  



  .............
  

 


 

 
Template Sequence  HVFTMYMREEINLQD. . . . . . . . . . . . . IEDISKKIAQERM
Template Known Secondary structure  TTSS
GGG.............G
Template Predicted Secondary structure 




.............
Template SS confidence 








































   48.50.........60.. .......70.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions