Return to main results Retrieve Phyre Job Id

Job DescriptionP0A910
Confidence20.37%DateThu Jan 5 11:09:07 GMT 2012
Rank97Aligned Residues35
% Identity20%Templatec3ce8A_
PDB info PDB header:unknown functionChain: A: PDB Molecule:putative pii-like nitrogen regulatory protein; PDBTitle: crystal structure of a duf3240 family protein (sbal_0098) from2 shewanella baltica os155 at 2.40 a resolution
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   279280........ .290.. .......300.........310.........320.........330....
Predicted Secondary structure 
.


.






















Query SS confidence 









.



.









































Query Sequence  QSVVDYLISK. GIPA. DKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEV
Query Conservation   

   
   .

  . 

   
 

  
 
 
 
  

         
 




  
Alig confidence 









.



.









..........



...........






Template Conservation    


 

     



     


 .......... 
  ...........  
   
Template Sequence  DDIVDTLIELEFLSGFSLGNICGFSR. . . . . . . . . . EGYR. . . . . . . . . . . EFCKFEI
Template Known Secondary structure  TT
TT




..........
...........
Template Predicted Secondary structure 














..........



...........
Template SS confidence 

























































   17..20.........30.........40.. .... ...50...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions