Return to main results Retrieve Phyre Job Id

Job DescriptionP37674
Confidence0.98%DateThu Jan 5 11:56:48 GMT 2012
Rank71Aligned Residues27
% Identity19%Templated1rkla_
SCOP infoSingle transmembrane helix Oligosaccharyltransferase subunit ost4p Oligosaccharyltransferase subunit ost4p
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   123......130.........140.........150.....
Predicted Secondary structure 









Query SS confidence 
































Query Sequence  AACLPTSLVIAFFELRHLYQLITRSNSLTSPPQ
Query Conservation          
  
  
  
   
          
Alig confidence 


















......







Template Conservation 


















......







Template Sequence  LAITFGIVMMTLIVIYHAV. . . . . . DSTMSPKN
Template Known Secondary structure  ......TS





Template Predicted Secondary structure  ......





Template SS confidence 
































   10.........20........ .30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions