Return to main results Retrieve Phyre Job Id

Job DescriptionP37674
Confidence1.88%DateThu Jan 5 11:56:48 GMT 2012
Rank26Aligned Residues23
% Identity22%Templatec2nytB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:probable c->u-editing enzyme apobec-2; PDBTitle: the apobec2 crystal structure and functional implications2 for aid
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   37..40.........50.........60.........70..
Predicted Secondary structure 




Query SS confidence 



































Query Sequence  VDELSRYLFVWLTFIGAIVAFMDNAHVQVTFLVEKL
Query Conservation    

   
     


         

 

 
   
Alig confidence 






.............















Template Conservation 
  

 
.............
     
 
 

 


Template Sequence  ADRIIKT. . . . . . . . . . . . . LSKTKNLRLLILVGRL
Template Known Secondary structure  .............
TT
Template Predicted Secondary structure  .............


Template SS confidence 



































   132...... .140.........150....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions