Return to main results Retrieve Phyre Job Id

Job DescriptionP77231
Confidence2.59%DateThu Jan 5 12:26:37 GMT 2012
Rank67Aligned Residues36
% Identity31%Templated1nbwa3
SCOP infoRibonuclease H-like motif Actin-like ATPase domain ATPase domain of dehydratase reactivase alpha subunit
Resolution2.40

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   228.230.........240.........250.........260.........270. ........
Predicted Secondary structure 







..





Query SS confidence 











































. .







Query Sequence  VASRGGEGGLRWLQREAQTLLQKGGIRTPADLDYLRQFDRECIE. . RNLSPGGS
Query Conservation 
  
 
   
  
   
   
             
   
  
  ..  





Alig confidence 


















................








..







Template Conservation 
  

 

 

 


 

 ................ 

  
 



 





 
Template Sequence  IDNASPLEKIRLVRRQAKE. . . . . . . . . . . . . . . . KVFVTNCLRALRQVSPGGS
Template Known Secondary structure 

SS
................SSSSTT

Template Predicted Secondary structure 





................





Template SS confidence 





















































   510.........520........ .530.........540.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions